General Information

  • ID:  hor002989
  • Uniprot ID:  P01160
  • Protein name:  Urodilatin
  • Gene name:  NPPA
  • Organism:  Homo sapiens (Human)
  • Family:  Natriuretic peptide family
  • Source:  Human
  • Expression:  [Urodilatin]: Detected in the kidney distal tubular cells (at protein level) .
  • Disease:  Diseases associated with NPPA include Atrial Standstill 2 and Atrial Fibrillation, Familial, 6.
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005102 signaling receptor binding; GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0005515 protein binding; GO:0051427 hormone receptor binding; GO:0071855 neuropeptide receptor binding
  • GO BP:  GO:0003008 system process; GO:0003085 negative regulation of systemic arterial blood pressure; GO:0003161 cardiac conduction system development; GO:0003180 aortic valve morphogenesis; GO:0006182 cGMP biosynthetic process; GO:0006457 protein folding; GO:0007168 receptor guanylyl cyclase signaling pathway; GO:0007218 neuropeptide signaling pathway; GO:0007565 female pregnancy; GO:0008217 regulation of blood pressure; GO:0010460 positive regulation of heart rate; GO:0014898 cardiac muscle hypertrophy in response to stress; GO:0019934 cGMP-mediated signaling; GO:0035994 response to muscle stretch; GO:0036376 sodium ion export across plasma membrane; GO:0042311 vasodilation; GO:0043508 negative regulation of JUN kinase activity; GO:0045776 negative regulation of blood pressure; GO:0060372 regulation of atrial cardiac muscle cell membrane repolarization; GO:0060452 positive regulation of cardiac muscle contraction; GO:0097746 blood vessel diameter maintenance; GO:1901841 regulation of high voltage-gated calcium channel activity; GO:1902261 positive regulation of delayed rectifier potassium channel activity; GO:1902514 regulation of calcium ion transmembrane transport via high voltage-gated calcium channel; GO:1903766 positive regulation of potassium ion export across plasma membrane
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005737 cytoplasm; GO:0032991 protein-containing complex; GO:0042995 cell projection; GO:0043204 perikaryon; GO:0062023 collagen-containing extracellular matrix

Sequence Information

  • Sequence:  TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY
  • Length:  32
  • Propeptide:  MSSFSTTTVSFLLLLAFQLLGQTRANPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPPQVLSEPNEEAGAALSPLPEVPPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKLRALLTAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY
  • Signal peptide:  MSSFSTTTVSFLLLLAFQLLGQTRA
  • Modification:  T10 Phosphoserine
  • Glycosylation:  NA
  • Mutagenesis:  4-4R->G: Loss of cleavage by CORIN.; 5-10R->G: Loss of cleavage by CORIN.; 5-7R->G: Loss of cleavage by CORIN.; 28-32R->G: Loss of cleavage by CORIN.

Activity

  • Function:  Hormone produced in the kidneys that appears to be important for maintaining cardio-renal homeostasis. Mediates vasodilation, natriuresis and diuresis primarily in the renal system, in order to maintain the extracellular fluid volume and control the fluid-electrolyte balance. Specifically binds and stimulates cGMP production by renal transmembrane receptors, likely NPR1. Urodilatin not ANP, may be the natriuretic peptide responsible for the regulation of sodium and water homeostasis in the kidney.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NPR3, NPR1
  • Target Unid:  P17342, P16066
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  11-27
  • Structure ID:  AF-O24572-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-O24572-F1.pdbhor002989_AF2.pdbhor002989_ESM.pdb

Physical Information

Mass: 406107 Formula: C145H236N52O44S3
Absent amino acids: EHKVW Common amino acids: R
pI: 11.81 Basic residues: 6
Polar residues: 15 Hydrophobic residues: 7
Hydrophobicity: -59.06 Boman Index: -9618
Half-Life: 7.2 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 42.81
Instability Index: 9087.81 Extinction Coefficient cystines: 1615
Absorbance 280nm: 52.1

Literature

  • PubMed ID:  NA
  • Title:  NA